PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang10g01550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 334aa    MW: 36936 Da    PI: 4.8453
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang10g01550.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++  +G g+W++ a++ g++Rt+k+c++rw++yl
   Vang10g01550.1 19 RGPWTLEEDNLLSQYISDHGEGRWNLLAKRSGLKRTGKSCRLRWLNYL 66
                     89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-221269IPR009057Homeodomain-like
PROSITE profilePS5129424.9681470IPR017930Myb domain
SMARTSM007177.9E-161868IPR001005SANT/Myb domain
PfamPF002495.6E-161966IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-212094IPR009057Homeodomain-like
CDDcd001675.05E-132166No hitNo description
Gene3DG3DSA:1.10.10.602.2E-67093IPR009057Homeodomain-like
SMARTSM007176771119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSTSKSVSSS SEDDNELRRG PWTLEEDNLL SQYISDHGEG RWNLLAKRSG LKRTGKSCRL  60
RWLNYLKPDV KRGNLTPQEQ LLILELHSKW GNRLLQKVKE SSSSSAMSIQ NQAIPLVLDD  120
GVSQQSTIGT IPWQGACVSM NGGSPTYMDQ HEQNSDSEHN SGSCISFSES ANMPKVSHHF  180
GHTMDQFHSL SNNDFGTYSY DPYHVNDNAY EMETFKAATA KVAQDVQYPI ADCQTAGTDW  240
LSNDFAYRSE LEWQNVHGFL IFYDGPICIG LLKPNIEESS HVNLTKLADY DLCSFANLNE  300
LVGCGLGSYA DLIELVVPLP GIVGPSSQEL GRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-1516112196MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510156.11e-158PREDICTED: transcription factor MYB24-like
TrEMBLA0A0L9THX61e-163A0A0L9THX6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QWQ81e-163A0A0S3QWQ8_PHAAN; Uncharacterized protein
STRINGGLYMA05G35050.11e-119(Glycine max)
STRINGGLYMA08G04670.11e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.15e-44myb domain protein 116